PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF019300020CFD_t1
Common NameTRAES_3BF019300020CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 178aa    MW: 20591.2 Da    PI: 10.4344
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF019300020CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.61.4e-081359145
                             TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                             r +W +eEd+ +  a  +l+ +   +W+++a++++ gRt+ +  +++q
  TRAES3BF019300020CFD_t1 13 RRPWAKEEDKAFEAALVMLPDHapdRWERVAARLP-GRTPQEAWEHYQ 59
                             679*****************99*************.****98777777 PP

2Myb_DNA-binding45.71.5e-14111155347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +W++eE++l++d+ +++G g+W+ I+r     Rt+ q+ s+ qky
  TRAES3BF019300020CFD_t1 111 PWSEEEHKLFLDGLEKYGRGDWRNISRFAVRSRTPTQVASHAQKY 155
                              7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512947.822966IPR017930Myb domain
SMARTSM007174.8E-51264IPR001005SANT/Myb domain
SuperFamilySSF466891.08E-101261IPR009057Homeodomain-like
PfamPF002491.0E-61359IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-61360IPR009057Homeodomain-like
CDDcd001672.11E-51553No hitNo description
PROSITE profilePS5129417.856104160IPR017930Myb domain
SuperFamilySSF466894.95E-17106161IPR009057Homeodomain-like
SMARTSM007179.7E-11108158IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.4E-16109159IPR006447Myb domain, plants
CDDcd001676.52E-11111156No hitNo description
PfamPF002495.7E-12111155IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-11111154IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MDFYYQQAGP PARRPWAKEE DKAFEAALVM LPDHAPDRWE RVAARLPGRT PQEAWEHYQA  60
LVADVDLIER GXXXXXXXXX XXXXXXXRAT VASRGRPAGK PRGEERRRGI PWSEEEHKLF  120
LDGLEKYGRG DWRNISRFAV RSRTPTQVAS HAQKYFIRQA NAATRDSKRK SIHDITTP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-131471966RADIALIS
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703061e-142HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003567296.11e-85PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H79e-48DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A077S5T51e-113A0A077S5T5_WHEAT; Uncharacterized protein
STRINGBRADI2G55797.17e-81(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.14e-48Homeodomain-like transcriptional regulator
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]